On SmartCustomer, businesses may not offer incentives or pay to remove reviews. Learn more about our Review Guidelines.
From the business
Access over 2 billion public records from thousands of federal, state, city and municipal sources
Records Finder Reviews Summary
Records Finder has a rating of 3.6 stars from 8,123 reviews, indicating that most customers are generally satisfied with their purchases. Reviewers satisfied with Records Finder most frequently mention customer service, easy access and background check. Records Finder ranks 4th among Government Records sites.
We monitor reviews for authenticity
I know there was additional traffic violations that were not on the record I searched.
Hello Dale,
Thank you for providing feedback on your recent search experience. We sincerely apologize for any inconvenience you may have faced and appreciate your insights.
To better assist you, could you please provide more details about the specific information you were looking for? This will enable us to address any gaps and enhance our search capabilities.
We are committed to delivering a better user experience, and your input plays a crucial role in this process. Please contact us via email at [email protected] or call us at 833-922-2315. We are here to help and look forward to addressing your needs.
Best regards,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Hello Nic,
Thank you for taking the time to provide feedback. However, it is a bit unclear. If you have specific thoughts, concerns, or suggestions, we would be more than happy to address them. Clear communication is essential for us to understand and respond effectively to your needs.
Please feel free to provide additional details or clarify your feedback so that we can better assist you.
Thank you for your understanding.
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
The agent was very friendly and informative. She worked swiftly to get the issue resolved. I was very satisfied with the agent's customer service.
Hello Triasia,
We appreciate your positive feedback! It's wonderful to hear that our agent's friendliness and efficiency contributed to a satisfying customer service experience for you. If you ever have more questions or encounter any issues in the future, please feel free to reach out. We're here to assist you!
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Excellent customer service researching and resolving my problem.
Hello Hedley,
Thank you for your kind words! We're delighted to hear that you found our customer service to be excellent in researching and resolving your problem. If you have any more questions or need further assistance in the future, please don't hesitate to reach out. We're here to help!
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Hello Amit,
Thank you for sharing your experience with us! We are happy that you are satisfied with the assistance you received. We look forward to working with you again. Have a nice day ahead, and stay safe!
Sincerely,
Zyra
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
I enjoyed everything about this and I hope it helps more people down the line
Hello Jose,
Thank you so much for taking the time to share your positive experience! We're thrilled to hear that you enjoyed using our service, and your kind words truly mean a lot to us. We hope you recommend us to others!
If you need anything else, please do not hesitate to contact us at your most convenient time. Have a nice day ahead, and stay safe!
Sincerely,
Zyra
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Hello Adam,
Thank you for your feedback! We appreciate your positive response. If you have any specific comments or suggestions you'd like to share, we'd love to hear them to further improve our services. Your input is valuable to us!
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Search only took a few minutes and received all the info I was needing
Hello Rena,
I'm glad to hear that your search was efficient and successful! If you have any more questions or if there's anything else I can help you with, feel free to let me know. Happy to assist!
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Good so far I have had an amazing experience doing this
Hello Brien,
Thank you for taking the time to share your feedback with us! We're delighted to hear that you've had an amazing experience so far. Your satisfaction is our priority, and we're committed to ensuring that your experience continues to be positive and enjoyable.
If there is anything else we can help you with, please do not hesitate to reach out. Once again, thank you for choosing us, and we look forward to continuing to provide you with an amazing experience.
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
So kind and immediately took care of the issue. Not only resolved it right away but made sure I had record of it as well! He is an excellent addition to your staff and should be teaching other representatives how to take calls and train.
Hello Jouleyanne,
Thank you so much for your incredibly kind and appreciative words! We're delighted to hear about your positive experience with our representative. Providing excellent service and prompt issue resolution is always our top priority.
Your feedback has been shared with our team, and we genuinely appreciate the recognition of our representative's efforts. It's feedback like yours that motivates us to continually strive for excellence in customer service. We hope that you will also recommend us to others.
If you need anything else, please do not hesitate to contact us at your most convenient time. Have a nice day ahead, and stay safe!
Sincerely,
Zyra
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
I never got the info that i needed but i dont think is was your fault but the person who wrecked in to e fault!
Hello MaryAnna,
Thank you for taking the time to give us a review. Please accept my apologies if we were not able to satisfy your needs. We want to change your experience and double-check the information you need. If you wish, we can schedule a call as soon as you are free, or you can reach out to us via email at [email protected]. Rest assured, we're here to help you.
We look forward to hearing from you. Have a great day ahead, and stay safe!
Sincerely,
Zyra
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
I found the information was comprehensive. I wish I could have received a photo copy of my deed.
Hello Robert,
Thank you for taking the time to share your feedback and for your positive review. We're pleased to hear that you found the information comprehensive. Your satisfaction is important to us, and we appreciate your input.
Regarding your concern, as of the moment, a photocopy of your deed is not yet part of our service. In the meantime, please request access to needed records from your nearest DMV. If you need anything else, please do not hesitate to contact us at your most convenient time. Have a nice day ahead, and stay safe!
Sincerely,
Zyra
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Didn't have everything I was looking for so that's where I'm at with this review
Hello Zachary,
Thank you for providing feedback. We apologize for any missing information and would like to assist you promptly. Please contact us via email at [email protected] or call us at 833-922-2315. We are here to help and look forward to addressing your needs.
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
This report on MYSELF was NOT requested by me. My phone & then identity were stolen end of February of this year. This was almost requested by the thief who helped himself to my banking account & various apps (Uber, Lyft, etc.). Please inform me re this "Wilfredo," who used my name & my $ to make this request,
Charles Schille
*******497
Hello Charles,
I'm truly sorry to hear about the distressing situation you've experienced. Identity theft is a serious matter. It's crucial to act swiftly in such cases. I'd recommend reporting this to the authorities to safeguard your identity. On our end, the account has been deactivated, and I've refunded the $2.95 fee. Please anticipate the refund to appear in your account within 3 to 5 business days.
If we can help you with anything else, we can schedule a call whenever you are available, or you can contact us via email at [email protected] or call us at 833-922-2315. Please know that we are here to assist you. Take care!
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Just needed one report and I got what I needed very quickly. Pretty plain and simple
Hello Nonya,
We're thrilled we could assist you swiftly! If you ever need more, we're here to help. Thank you for your feedback!
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Flagged for checking on myself and family due t[car theft and identity theft. Which by the way the site is grossly inaccurate on everything
Hello Mason,
We're genuinely sorry to hear about your experience. Our primary goal is to provide accurate and reliable information, and we take such concerns seriously.
It is important to note that our records are meticulously gathered from publicly available sources. We make every effort to ensure accuracy, but given the nature of the sources, we can't guarantee the absolute accuracy of the information. It's essential to note that the materials and information we offer are presented "as is" and "as available," as we operate within the bounds of the data provided by these public sources, over which we have no direct control. I hope you understand.
If we can help you with anything else, we can schedule a call whenever you are available, or you can contact us via email at [email protected] or call us at 833-922-2315. Please know that we are here to assist you.
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Good. The information was accurate and informative. The search was relatively easy. I would use the service again in the future.
Hello Elizabeth,
Thank you for the feedback! I'm pleased to hear that you had a positive experience with the service. We are here to provide assistance, so if you ever need to use the service again in the future or have any more questions, please don't hesitate to reach out. Your positive experience is important, and We are here to help you with any information or support you may need.
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
While report was searching it said it had the name and other data. It did not show up on the regular report. For more information I was encouraged to buy the premium package for $9. Again no owners name on the report. These sites suck you in and don't give the information you are looking for. The cancellation process went smooth.
Hello John,
Thank you for your feedback. We apologize for the inconvenience. I searched on my end to see if I could help yield the results you may need, but I was unsuccessful. It could be that the license plate might be restricted access under the Driver’s Privacy Protection Act (DPPA) protection. I hope you understand.
Furthermore, I refunded the fee of $9.95. Please allow 3 -5 business days for the refund to reflect on your account. Please note your account is active. If you need to cancel any future charges please let us know.
If we can help you with anything else, we can schedule a call whenever you are available, or you can contact us via email at [email protected] or call us at 833-922-2315. Please know that we are here to assist you.
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Ggjjccttfffyfcttffrrerhhfeegggrtgfewwfhiiydfvhfwwmhewfg
Hello Salvador,
It seems like you've provided a random sequence of letters and characters. Is there a specific question or topic you'd like me to address? Please provide more context, and I'll be happy to help. Please contact us at [email protected] or call 833-922-2315. We look forward to hearing from you.
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
See reviews as you browse!
Get the Chrome Extension.
Add Extension
- SmartCustomer’s sole mission is to increase online transparency for buyers and businesses
- SmartCustomer has helped over 200M buyers make better purchasing decisions online
- Suspicious reviews are flagged by our algorithms, moderators, and community members
- SmartCustomer’s sole mission is to increase online transparency for buyers and businesses
- SmartCustomer has helped over 200M buyers make better purchasing decisions online
- Suspicious reviews are flagged by our algorithms, moderators, and community members
Hello,
Thank you for taking the time to share your thoughts with us. We value your feedback, and while we appreciate concise comments, we'd love to learn more about your experience.
If there's anything specific you'd like to discuss or if you have suggestions for improvement, please feel free to share them with us. We look forward to the opportunity to better serve you!
Best regards,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315